« Back
Home /
Recombinant Human Lutropin-choriogonadotropic hormone receptor(LHCGR),partial

Recombinant Human Lutropin-choriogonadotropic hormone receptor(LHCGR),partial

Manufacturer	Cusabio
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	Mammalian cells
Item no.	CSB-MP012911HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cardiovascular
Uniprot ID	P22888
Gene Names	LHCGR
Organism	Homo sapiens (Human)
AA Sequence	EALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPV KVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDN LLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSIC NTGIRKFPDVTKVFSSESNFILEICDNLHITTIPG NAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTS LELKENVHLEKMHNGAFRGATGPKTLDISSTKLQA LPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEA TLTYPSHCCAFRNLPTKEQNFSHSISENFSKQCES TVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTP RCAPEPDAFNPCEDIMGYDFL
Expression Region	27-362aa
Sequence Info	Full Length of Mature Protein
Source	Mammalian cell
Tag Info	N-terminal 6xHis-tagged
MW	41.4 kDa
Alternative Name(s)	Luteinizing hormone receptor Short name: LHR Short name: LSH-R
Relevance	Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Reference	"Cloning and sequencing of human LH/hCG receptor cDNA."Minegish T., Nakamura K., Takakura Y., Miyamoto K., Hasegawa Y., Ibuki Y., Igarashi M.Biochem. Biophys. Res. Commun. 172:1049-1054(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for lutropin-choriogonadotropic hormone
Involvement in disease	Familial male precocious puberty (FMPP); Luteinizing hormone resistance (LHR)
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity	Gonadal and thyroid cells.
Paythway	Calciumsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP012911HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time