« Back
Home /
Recombinant Human Melanoma-associated antigen 1 (MAGEA1)

Recombinant Human Melanoma-associated antigen 1 (MAGEA1)

Manufacturer	Cusabio
Category	Oncology Neuroscience Aging & Neurological Disorders Neural Epigenetics Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Testicular & Prostate Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	20ug
Host	Mammalian cells
Item no.	CSB-MP013323HU-20
Conjugate/Tag	FLAG, Myc
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Cancer
Uniprot ID	P43355
Gene Names	MAGEA1
Organism	Homo sapiens (Human)
AA Sequence	MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSS SPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKK VADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCL GLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQ EKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVL EYVIKVSARVRFFFPSLREAALREEEEGV
Expression Region	1-309aa
Sequence Info	Full Length
Source	Mammalian cell
Tag Info	N-terminal Flag-Myc-tagged
MW	38.8 kDa
Alternative Name(s)	Antigen MZ2-E Cancer/testis antigen 1.1 Short name: CT1.1 MAGE-1 antigen
Relevance	May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Reference	Cloning of human full-length CDSs in BD Creator(TM) system donor vector.Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Subcellular Location	Cytoplasm, Nucleus
Tissue Specificity	Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. Never expressed in kidney tumors, leukemias and lymphomas.
Tag Information	N-terminal Flag-Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP013323HU-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time