Comparison

Recombinant Mouse Myoglobin(Mb)

Item no. CSB-MP013529MO-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Mouse (Murine, Mus musculus)
Host Mammalian cells
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKT HPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLT ALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLE FISEIIIEVLKKRHSGDFGADAQGAMSKALELFRN DIAAKYKELGFQG
Protein Family Globin family
Citations The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes.
Blanchetot A., Price M., Jeffreys A.J.
Eur. J. Biochem. 159:469-474(1986)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
21.9 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cancer
Relevance
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Biologically Active
Not Test
Expression Region
2-154aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Delivery expected until 9/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close