Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Format |
Liquid or Lyophilized powder |
Amount |
100ug |
Host |
Mammalian cells |
Item no. |
CSB-MP017381HU-100 |
Conjugate/Tag |
Myc |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Tags & Cell Markers |
Target / Protein |
PAEP |
Biologically Active |
Not Test |
Expression System |
Mammalian cell |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P09466 |
AA Sequence |
MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATL KAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKK VLGEKTENPKKFKINYTVANEATLLDTDYDNFLFL CLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAF RPLPRHLWYLLDLKQMEEPCRF |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Expression Region |
19-180aa |
Protein Length |
Full Length of Mature Protein |
MW |
23, 9 |
Distributor Discount |
50% off the list price |
Alternative Name(s) |
Placental protein 14 Short name:PP14 |
Relevance |
This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy. |
Reference |
Multiple forms of mRNA encoding human pregnancy-associated endometrial alpha 2-globulin, a beta-lactoglobulin homologue.Garde J., Bell S.C., Eperon I.C.Proc. Natl. Acad. Sci. U.S.A. 88:2456-2460(1991) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities |
Subcellular Location |
Secreted |
Protein Families |
Calycin superfamily, Lipocalin family |
Tissue Specificity |
This protein is, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy (PubMed:3667877). Glycodelin-A is expressed in amniotic fluid, endometrium/decidua and maternal serum (at protein level) (PubMed:3194393). Glycodelin-F is expressed in follicular fluid, luteinized granulosa cells and the oviduct (at protein level) (PubMed:12672671). Glycodelin-S is expressed in seminal plasma and seminal vesicles (at protein level) (PubMed:9239694). Glycodelin-C is detected in cumulus cells (at protein level), but cumulus cells do not synthesize Glycodelin-C but take up and convert glycodelin-A and -F vis glycan remodeling (PubMed:17192260). |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.