Comparison

Recombinant Human Guanylate cyclase activator 2B(GUCA2B)

Item no. CSB-MP613693HU-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Mammalian cells
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQS LLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIA NDDCELCVNVACTGCL
Protein Family Guanylin family
Citations One peptide, two topologies structure and interconversion dynamics of human uroguanylin isomers.Marx U.C., Klodt J., Meyer M., Gerlach H., Roesch P., Forssmann W.-G., Adermann K.J. Pept. Res. 52:229-240(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Guanylate cyclase C-activating peptide II ;GCAP-IIUroguanylin ;UGN
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
13.5 kDa
General Research Areas
Signal Transduction
Relevance
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Expression Region
27-112aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Subcellular Location
Secreted
Tissue Specificity
Stomach and intestine.
Gene Names
GUCA2B
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close