Comparison

Recombinant Human Fc receptor-like protein 6(FCRL6),partial

Item no. CSB-MP718779HU-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Mammalian cells
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYR DGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMY IPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPRE GSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDR GPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSP QLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCE AQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFP VKS
Citations FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection.Wilson T.J., Presti R.M., Tassi I., Overton E.T., Cella M., Colonna M.Blood 109:3786-3793(2007)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fc receptor homolog 6 (FcRH6) (IFGP6)
Available
Manufacturer - Targets
FCRL6
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
35.2 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Immunology
Expression Region
20-307aa
Protein Length
Extracellular Domain
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as a MHC class II receptor
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Expressed by cytolytic cells including NK cells, effector and effector-memory CD8(+) T-cells, and a subset of NKT cells (at protein level) (PubMed:17213291, PubMed:18991291, PubMed:20933011). Also expressed in gamma delta T cells and in a rare subset of effector CD4(+) T-cells (at protein level) (PubMed:18991291). Expressed in spleen, skin, peripheral blood leukocytes, liver, lung, bone marrow, small intestine and placenta (PubMed:20933011). Expression among T-cells is greatly expanded in HIV-1 infected individuals, and includes not only effector and effector-memory CD8(+) T-cells but also populations of CD4(+) T-cells (PubMed:17213291, PubMed:20933011). Expression among CD8(+) T-cells and NK cells is expanded in individuals with chronic lymphocytic leukemia (CLL) but is reduced in PBMCs from patients with acute (AML), chronic myeloid leukemia (CML) and non-Hodgkin's lymphoma (PubMed:18991291, PubMed:20933011). Expression is higher in PBMCs and/or CD3(+) cells of patients with autoimmune diseases, such as rheumatoid arthritis (RA), systemic lupus erythematosus (SLE) and idiopathic thrombocytopenia purpura (ITP) (PubMed:20933011). In contrast, expression in CD3(+) cells from patients with lupus anticoagulans (LA) is higher (PubMed:20933011).
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Delivery expected until 11/13/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close