Comparison

Recombinant Sudan ebolavirus Envelope glycoprotein (GP) ,partial

Item no. CSB-MP742487SRE-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Mammalian cells
Conjugate/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFG PGAEGIYTEGLMHNQNALVCGLRQLANETTQALQL FLRATTELRTYTILNRKAIDFLLRRWGGTCRILGP DCCIEPHDWTKNITDKINQIIHDFIDNPLPN
Protein Family Filoviruses glycoprotein family
Citations "The virion glycoproteins of Ebola viruses are encoded in two reading frames and are expressed through transcriptional editing."Sanchez A., Trappier S.G., Mahy B.W.J., Peters C.J., Nichol S.T.Proc. Natl. Acad. Sci. U.S.A. 93:3602-3607(1996)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GP1,2; Short name:; GP
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
19.4 kDa
Relevance
GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also seems to enhance virus infectivity.
Expression Region
502-637aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion.
Subcellular Location
GP2: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Note=In the cell, localizes to the plasma membrane lipid rafts, which probably represent the assembly and budding site, SUBCELLULAR LOCATION: GP1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Note=GP1 is not anchored to the viral envelope, but forms a disulfid-linked complex with the extravirion surface GP2, In the cell, both GP1 and GP2 localize to the plasma membrane lipid rafts, which probably represent the assembly and budding site, GP1 can also be shed after proteolytic processing, SUBCELLULAR LOCATION: GP2-delta: Secreted
Gene Names
GP
Sequence Info
Partial
Organism
Sudan ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola virus)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close