« Back
Home /
Recombinant Norwalk virus Capsid protein VP1(ORF2)

Recombinant Norwalk virus Capsid protein VP1(ORF2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Format	Liquid or Lyophilized powder
Amount	20ug
Host	Mammalian cells
Item no.	CSB-MP767779NBAY-20
Conjugate/Tag	FLAG, Myc
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Others
Target / Protein	ORF2
Biologically Active	Not Test
Expression System	Mammalian cell
Species of origin	Norwalk virus (strain GI/Human/United States/Norwalk/1968) (Hu/NV/NV/1968/US)
Uniprot ID	Q83884
AA Sequence	MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDP VAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTI SPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNGWVG NMRVRIMLAGNAFTAGKIIVSCIPPGFGSHNLTIA QATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDR NQQTMRLVCMLYTPLRTGGGTGDSFVVAGRVMTCP SPDFNFLFLVPPTVEQKTRPFTLPNLPLSSLSNSR APLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTT PVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGP APIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPD TFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGS QVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVF FMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGE AALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASS GPQQLPINGVFVFVSWVSRFYQLKPVGTASSARGR LGLRR
Tag Info	C-terminal Flag-Myc-tagged
Expression Region	1-530aa
Protein Length	Full Length
MW	59.6 kDa
Distributor Discount	50% off the list price
Alternative Name(s)	p59
Relevance	Capsid protein self assbles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assbled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.
Reference	X-ray crystallographic structure of the Norwalk virus capsid.Prasad B.V.V., Hardy M.E., Dokland T., Bella J., Rossmann M.G., Estes M.K.Science 286:287-290(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assembled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.
Subcellular Location	Virion, Host cytoplasm
Protein Families	Caliciviridae capsid protein family
Tag Information	C-terminal Flag-Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP767779NBAY-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time