Recombinant Human Casein kinase I isoform epsilon(CSNK1E),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
ArtNr CSB-RP013154h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P49674
Gene Names
CSNK1E
Organism
Homo sapiens (Human)
AA Sequence
SGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHI ESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLG PSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHS KNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKY RDARTHQHIPYRENKNLTGTARYASINTHLGIEQS RRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYE RISEK
Expression Region
17-231aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
51.5 kDa
Relevance
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates DVL1. Central component of the circadian clock. In balance with PP1, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phospohorylation. Controls PER1 and PER2 nuclear transport and degradation. Inhibits cytokine-induced granuloytic differentiation.
Reference
A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close