Recombinant Human Proteasome subunit beta type-7(PSMB7),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP013454h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
O14818
Gene Names
PSMB7
Organism
Homo sapiens (Human)
AA Sequence
GVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTA DARIVINRARVECQSHRLTVEDPVTVEYITRYIAS LKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTD PSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIET DDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLK ILNPEEIEKYVAEIEKEKEENEKKKQKKAS
Expression Region
44-275aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
50.2 kDa
Alternative Name(s)
Proteasome subunit R; C6-1; Proteasome subunit XAPC7
Relevance
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Plays an important role in the regulation of cell proliferation or cell cycle control, transcriptional regulation, immune and stress response, cell differentiation, and apoptosis. Interacts with some important proteins involved in transcription factor regulation, cell cycle transition, viral replication and even tumor initiation and progression. Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with AP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation. Promotes MAVS degradation and thereby negatively regulates MAVS-mediated innate immune response.
Reference
Proteasome complex as a potential cellular target of hepatitis B virus X protein.Huang J., Kwong J., Sun E.C.-Y., Liang T.J.J. Virol. 70:5582-5591(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close