Comparison

Recombinant Human Histone H2B type 1-C/E/F/G/I(HIST1H2BC)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP016944h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Histone H2B.1 AHistone H2B.a ; H2B/aHistone H2B.g ; H2B/gHistone H2B.h ; H2B/hHistone H2B.k ; H2B/kHistone H2B.l ; H2B/l
AA Sequence
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKE SYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIF ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGE LAKHAVSEGTKAVTKYTSS
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P62807
Gene Names
HIST1H2BC
Tag Info
N-terminal GST-tagged
Expression Region
2-125aa
MW of Fusion Proten
40, 6
Sequence Info
Full Length
Relevance
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
Reference
Isolation and characterization of two human H1 histone genes within clusters of core histone genes.Albig W., Kardalinou E., Drabent B., Zimmer A., Doenecke D.Genomics 10:940-948(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close