Recombinant Human 60S ribosomal protein L36a-like(RPL36AL)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
Item no. CSB-RP018044h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q969Q0
Gene Names
RPL36AL
Organism
Homo sapiens (Human)
AA Sequence
MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYA QGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQ
Expression Region
1-106aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
39.5 kDa
Reference
Characterisation of an mRNA encoding a human ribosomal protein homologous to the yeast L44 ribosomal protein.Davies M.S., Henney A., Ward W.H.J., Craig R.K.Gene 45:183-191(1986)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close