Recombinant Human ES1 protein homolog, mitochondrial(C21orf33)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP018144h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P30042
Gene Names
C21orf33
Organism
Homo sapiens (Human)
AA Sequence
ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEV QIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARI ARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFA VDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVL AAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALG AKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIH DGIGAMVRKVLELTGK
Expression Region
43-268aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
50.9 kDa
Alternative Name(s)
Protein GT335Protein KNP-I
Reference
The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close