« Back
Home /
Recombinant Human Rhombotin-1(LMO1),partial

Recombinant Human Rhombotin-1(LMO1),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-RP020544h-200
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	P25800
Gene Names	LMO1
Organism	Homo sapiens (Human)
AA Sequence	DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKA LDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILC RRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVY HLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEE GQLNGTFESQVQ
Expression Region	5-156aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	44.4 kDa
Alternative Name(s)	Cysteine-rich protein TTG-1LIM domain only protein 1 ; LMO-1T-cell translocation protein 1
Relevance	May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Reference	Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Involvement in disease	A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11, 14)(p15; q11) with TCRD.
Subcellular Location	Nucleus
Tissue Specificity	Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time