Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5(NDUFS5)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
Item no. CSB-RP027354h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
O43920
Gene Names
NDUFS5
Organism
Homo sapiens (Human)
AA Sequence
PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAF EKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQK TMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
Expression Region
2-106aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
39.4 kDa
Alternative Name(s)
Complex I-15KDA ; CI-15KDANADH-ubiquinone oxidoreductase 15KDA subunit
Relevance
Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference
The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.Murray J., Zhang B., Taylor S.W., Oglesbee D., Fahy E., Marusich M.F., Ghosh S.S., Capaldi R.A.J. Biol. Chem. 278:13619-13622(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close