Comparison

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2(NDUFA2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP029854h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
O43678
Gene Names
NDUFA2
Organism
Homo sapiens (Human)
AA Sequence
AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIE KRYVELKKANPDLPILIRECSDVQPKLWARYAFGQ ETNVPLNNFSADQVTRALENVLSGKA
Expression Region
4-99aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
37.6 kDa
Alternative Name
Complex I-B8 . CI-B8NADH-ubiquinone oxidoreductase B8 subunit
Relevance
Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference
Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.Ton C., Hwang D.M., Dempsey A.A., Liew C.-C.Biochem. Biophys. Res. Commun. 241:589-594(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location
Mitochondrion inner membrane, Peripheral membrane protein, Matrix side
Protein Families
Complex I NDUFA2 subunit family
Paythway
OxidativePhosphorylation
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close