Recombinant Human Eukaryotic translation initiation factor 3 subunit F(EIF3F),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP031054h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
O00303
Gene Names
EIF3F
Organism
Homo sapiens (Human)
AA Sequence
MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAA APVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDS YERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYAT GHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTE RIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQV PKIVPDDF
Expression Region
1-323aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
60.7 kDa
Alternative Name(s)
Deubiquitinating enzyme eIF3f (EC:3.4.19.12)
Relevance
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassbly and recycling of post-termination ribosomal complexes and subsequently prevents prature joining of the 40S and 60S ribosomal subunits prior to initiation.
Reference
Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.Asano K., Vornlocher H.-P., Richter-Cook N.J., Merrick W.C., Hinnebusch A.G., Hershey J.W.B.J. Biol. Chem. 272:27042-27052(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close