Comparison

Recombinant Human Polycomb complex protein BMI-1(BMI1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP033454h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Polycomb group RING finger protein 4RING finger protein 51
AA Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECL HSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSAD AANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQ NRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHL RKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIA YIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTN AGELE
Research Topic
Transcription
Uniprot ID
P35226
Gene Names
BMI1
Tag Info
N-terminal GST-tagged
Expression Region
1-250aa
MW of Fusion Proten
56, 4
Sequence Info
Partial
Relevance
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin rodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Reference
Characterization and chromosomal localization of the human proto-oncogene BMI-1.Alkema M.J., Wiegand J., Raap A.K., Berns A., van Lohuizen M.Hum. Mol. Genet. 2:1597-1603(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close