« Back
Home /
Recombinant Human Polycomb complex protein BMI-1(BMI1),partial

Recombinant Human Polycomb complex protein BMI-1(BMI1),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-RP033454h-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Transcription
Uniprot ID	P35226
Gene Names	BMI1
Organism	Homo sapiens (Human)
AA Sequence	MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECL HSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSAD AANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQ NRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHL RKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIA YIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTN AGELE
Expression Region	1-250aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	56.4 kDa
Alternative Name(s)	Polycomb group RING finger protein 4RING finger protein 51
Relevance	Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin rodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Reference	Characterization and chromosomal localization of the human proto-oncogene BMI-1.Alkema M.J., Wiegand J., Raap A.K., Berns A., van Lohuizen M.Hum. Mol. Genet. 2:1597-1603(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility
Subcellular Location	Nucleus, Cytoplasm

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time