Recombinant Human DnaJ homolog subfamily B member 1(DNAJB1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
ArtNr CSB-RP039344h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P25685
Gene Names
DNAJB1
Organism
Homo sapiens (Human)
AA Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDK NKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEF FGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEI YSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHN IFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLI IEFEVIFPERIPQTSRTVLEQVLPI
Expression Region
1-340aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
65 kDa
Alternative Name(s)
DnaJ protein homolog 1Heat shock 40KDA protein 1 ; HSP40 ; Heat shock protein 40Human DnaJ protein 1 ; hDj-1
Relevance
Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.
Reference
The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close