« Back
Home /
Recombinant Human AFG3-like protein 2(AFG3L2),partial

Recombinant Human AFG3-like protein 2(AFG3L2),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-RP040044h-200
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Metabolism
Uniprot ID	Q9Y4W6
Gene Names	AFG3L2
Organism	Homo sapiens (Human)
AA Sequence	ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWY LEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKE QLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVT QSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPY SEATARLIDDEVRILINDAYKRTVALLTEKKADVE KVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF
Expression Region	550-759aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	50.8 kDa
Alternative Name(s)	Paraplegin-like protein
Relevance	ATP-dependent protease which is essential for axonal development.
Reference	Identification and characterization of AFG3L2, a novel paraplegin-related gene.Banfi S., Bassi M.T., Andolfi G., Marchitiello A., Zanotta S., Ballabio A., Casari G., Franco B.Genomics 59:51-58(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	ATP-dependent protease which is essential for axonal and neuron development. In neurons, mediates degradation of SMDT1/EMRE before its assembly with the uniporter complex, limiting the availability of SMDT1/EMRE for MCU assembly and promoting efficient assembly of gatekeeper subunits with MCU
Involvement in disease	Spinocerebellar ataxia 28 (SCA28); Spastic ataxia 5, autosomal recessive (SPAX5)
Subcellular Location	Mitochondrion, Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families	AAA ATPase family; Peptidase M41 family
Tissue Specificity	Ubiquitous. Highly expressed in the cerebellar Purkinje cells.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time