Comparison

Recombinant Human AFG3-like protein 2(AFG3L2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP040044h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Paraplegin-like protein
AA Sequence
ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWY LEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKE QLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVT QSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPY SEATARLIDDEVRILINDAYKRTVALLTEKKADVE KVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF
Research Topic
Metabolism
Uniprot ID
Q9Y4W6
Gene Names
AFG3L2
Tag Info
N-terminal GST-tagged
Expression Region
550-759aa
MW of Fusion Proten
50, 8
Sequence Info
Partial
Relevance
ATP-dependent protease which is essential for axonal development.
Reference
Identification and characterization of AFG3L2, a novel paraplegin-related gene.Banfi S., Bassi M.T., Andolfi G., Marchitiello A., Zanotta S., Ballabio A., Casari G., Franco B.Genomics 59:51-58(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close