Comparison

Recombinant Human AFG3-like protein 2(AFG3L2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP040044h-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
Q9Y4W6
Gene Names
AFG3L2
Organism
Homo sapiens (Human)
AA Sequence
ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWY LEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKE QLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVT QSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPY SEATARLIDDEVRILINDAYKRTVALLTEKKADVE KVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF
Expression Region
550-759aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
50.8 kDa
Alternative Name
Paraplegin-like protein
Relevance
ATP-dependent protease which is essential for axonal development.
Reference
Identification and characterization of AFG3L2, a novel paraplegin-related gene.Banfi S., Bassi M.T., Andolfi G., Marchitiello A., Zanotta S., Ballabio A., Casari G., Franco B.Genomics 59:51-58(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
ATP-dependent protease which is essential for axonal and neuron development. In neurons, mediates degradation of SMDT1/EMRE before its assembly with the uniporter complex, limiting the availability of SMDT1/EMRE for MCU assembly and promoting efficient assembly of gatekeeper subunits with MCU
Involvement in disease
Spinocerebellar ataxia 28 (SCA28); Spastic ataxia 5, autosomal recessive (SPAX5)
Subcellular Location
Mitochondrion, Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families
AAA ATPase family; Peptidase M41 family
Tissue Specificity
Ubiquitous. Highly expressed in the cerebellar Purkinje cells.
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close