« Back
Home /
Recombinant Human Tax1-binding protein 3(TAX1BP3)

Recombinant Human Tax1-binding protein 3(TAX1BP3)

Manufacturer	Cusabio
Category	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-RP044454h-200
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	O14907
Gene Names	TAX1BP3
Organism	Homo sapiens (Human)
AA Sequence	MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGG GIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVV RLLVTRQSLQKAVQQSMLS
Expression Region	1-124aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	40.7 kDa
Alternative Name(s)	Glutaminase-interacting protein 3Tax interaction protein 1 ; TIP-1Tax-interacting protein 1
Relevance	May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
Reference	The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins.Rousset R., Fabre S., Desbois C., Bantignies F., Jalinot P.Oncogene 16:643-654(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
Subcellular Location	Cytoplasm, Nucleus, Cell membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity	Ubiquitous. Detected in brain, heart, kidney, lung, small intestine and skeletal muscle. Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time