« Back
Home /
Recombinant Human Breast cancer metastasis-suppressor 1(BRMS1),partial

Recombinant Human Breast cancer metastasis-suppressor 1(BRMS1),partial

Item no.	CSB-RP048144h-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Neuroscience Aging & Neurological Disorders Neural Epigenetics Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERS GSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPL GGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLD LSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG PYIVYMLQEIDILEDWTAIKKARAA
Protein Family	BRMS1 family
Citations	Functional evidence for a novel human breast carcinoma metastasis suppressor, BRMS1, encoded at chromosome 11q13.Seraj M.J., Samant R.S., Verderame M.F., Welch D.R.Cancer Res. 60:2764-2769(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	54.3 kDa
General Research Areas	Apoptosis
Relevance	Transcriptional repressor. Down-regulates transcription activation by NF-kappa-B by promoting the deacetylation of RELA at 'Lys-310'. Promotes HDAC1 binding to promoter regions. Down-regulates expression of anti-apoptotic genes that are controlled by NF-kappa-B. Promotes apoptosis in cells that have inadequate adherence to a substrate, a process called anoikis, and may thereby inhibit metastasis. May be a mediator of metastasis suppression in breast carcinoma.
Expression Region	1-235aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transcriptional repressor. Down-regulates transcription activation by NF-kappa-B by promoting the deacetylation of RELA at 'Lys-310'. Promotes HDAC1 binding to promoter regions. Down-regulates expression of anti-apoptotic genes that are controlled by NF-kappa-B. Promotes apoptosis in cells that have inadequate adherence to a substrate, a process called anoikis, and may thereby inhibit metastasis. May be a mediator of metastasis suppression in breast carcinoma.
Subcellular Location	Nucleus, Cytoplasm
Tissue Specificity	Expression levels are higher in term placentas than in early placentas. Low levels of expression observed in normal pregnancies and in molar pregnancies.
Gene Names	BRMS1
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-RP048144h-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer