Comparison

Recombinant Human 78 kDa glucose-regulated protein(HSPA5),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Lyophilized Powder
Amount 200ug
Host E.coli
Item no. CSB-RP050294h-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78Heat shock 70 kDa protein 5Immunoglobulin heavy chain-binding protein ; BiP
AA Sequence
EDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGN RITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFD AKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQ VDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKK VTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRII NEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSL LTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKL YKKKTGKDVRKDNRAVQKLRREVE
Research Topic
Others
Uniprot ID
P11021
Gene Names
HSPA5
Tag Info
N-terminal 6xHis-tagged
Expression Region
25-293aa
MW of Fusion Proten
33, 6
Sequence Info
Partial
Relevance
Probably plays a role in facilitating the assbly of multimeric protein complexes inside the endoplasmic reticulum. Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10, probably to facilitate the release of DNAJC10 from its substrate.
Reference
Chao C.C.K. Grp78 is involved in the quality control of the LDL-receptor.Hansen J.J., Nielsen M.N., Jorgensen M.M., Gregersen N., Bolund L. Sequence differences between human grp78/BiP isolated from HeLa cells and previously reported human sequences.Bermudez-Fajardo A., Llewellyn D.H., Campbell A.K., Errington R.R.NIEHS SNPs programDNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close