Comparison

Recombinant Human Protein canopy homolog 2(CNPY2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP050344h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
Q9Y2B0
Gene Names
CNPY2
Organism
Homo sapiens (Human)
AA Sequence
RSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSF RINPDGSQSVVEVPYARSEAHLTELLEEICDRMKE YGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRID SDISGTLKFACESIVEEYEDELIEFFSREADNVKD KLCSKRTDLCDHALHISHDEL
Expression Region
22-182aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
45.4 kDa
Alternative Name
MIR-interacting saposin-like protein. Putative secreted protein Zsig9Transmembrane protein 4
Relevance
Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
Reference
MSAP is a novel MIR-interacting protein that enhances neurite outgrowth and increases myosin regulatory light chain.Bornhauser B.C., Olsson P.-A., Lindholm D.J. Biol. Chem. 278:35412-35420(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
Subcellular Location
Endoplasmic reticulum
Protein Families
Canopy family
Tissue Specificity
Expressed in different tissues. Highest levels are detected in adult placenta, liver and pancreas.
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close