Recombinant Human Protein AATF(AATF),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP052644h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9NY61
Gene Names
AATF
Organism
Homo sapiens (Human)
AA Sequence
PLALQLEQLLNPRPSEADPEADPEEATAARVIDRF DEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKT TSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSE GLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAK TPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGM EEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSV KVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT TNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKAL LRSLVGLQE
Expression Region
6-294aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
58.8 kDa
Alternative Name(s)
Apoptosis-antagonizing transcription factorRb-binding protein Che-1
Relevance
May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacent of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dentia), although the molecular basis for this phenomenon has not been described to date.
Reference
Identification of novel transcription factor-like gene from human intestinal cells.Lindfors K., Halttunen T., Huotari P., Nupponen N., Vihinen M., Visakorpi T., Maki M., Kainulainen H.Biochem. Biophys. Res. Commun. 276:660-666(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close