Comparison

Recombinant Human Protein AATF(AATF),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP052644h-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Apoptosis-antagonizing transcription factorRb-binding protein Che-1
AA Sequence
PLALQLEQLLNPRPSEADPEADPEEATAARVIDRF DEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKT TSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSE GLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAK TPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGM EEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSV KVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT TNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKAL LRSLVGLQE
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9NY61
Gene Names
AATF
Tag Info
N-terminal GST-tagged
Expression Region
6-294aa
MW of Fusion Proten
58, 8
Sequence Info
Partial
Relevance
May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacent of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dentia), although the molecular basis for this phenomenon has not been described to date.
Reference
Identification of novel transcription factor-like gene from human intestinal cells.Lindfors K., Halttunen T., Huotari P., Nupponen N., Vihinen M., Visakorpi T., Maki M., Kainulainen H.Biochem. Biophys. Res. Commun. 276:660-666(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close