Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP052644h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q9NY61 |
Gene Names |
AATF |
Organism |
Homo sapiens (Human) |
AA Sequence |
PLALQLEQLLNPRPSEADPEADPEEATAARVIDRF DEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKT TSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSE GLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAK TPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGM EEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSV KVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT TNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKAL LRSLVGLQE |
Expression Region |
6-294aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
58.8 kDa |
Alternative Name(s) |
Apoptosis-antagonizing transcription factorRb-binding protein Che-1 |
Relevance |
May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacent of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dentia), although the molecular basis for this phenomenon has not been described to date. |
Reference |
Identification of novel transcription factor-like gene from human intestinal cells.Lindfors K., Halttunen T., Huotari P., Nupponen N., Vihinen M., Visakorpi T., Maki M., Kainulainen H.Biochem. Biophys. Res. Commun. 276:660-666(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date. |
Subcellular Location |
Nucleus, nucleolus |
Protein Families |
AATF family |
Tissue Specificity |
Ubiquitously expressed. Expressed at high levels in brain, heart, kidney, placenta and thymus. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.