Comparison

Recombinant Human PRKCA-binding protein(PICK1),partial

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 200ug
Host E.coli
Item no. CSB-RP054454h-200
Conjugate/Tag GST
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
Q9NRD5
Gene Names
PICK1
Organism
Homo sapiens (Human)
AA Sequence
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGI SIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQ ADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLR AFYELSQTHRAFGDVFSVIGVREPQ
Expression Region
1-200aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
48.9 kDa
Alternative Name(s)
Protein interacting with C kinase 1; Protein kinase C-alpha-binding protein
Relevance
Probable adapter protein that bind to and organize the subcellular localization of a variety of mbrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate ASIC1/ASIC3 channel. Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors and is linked to neuronal morphology regulation and AMPA receptor (AMPAR) endocytosis. Via interaction with the Arp2/3 complex involved in regulation of synaptic plasicity of excitatory synapses and required for spine shrinkage during long-term depression (LTD). Involved in regulation of astrocyte morphology, antagonistic to Arp2/3 complex activator WASL/N-WASP function.
Reference
Interaction of the PDZ domain of human PICK1 with class I ADP-ribosylation factors.Takeya R., Takeshige K., Sumimoto H.Biochem. Biophys. Res. Commun. 267:149-155(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate ASIC1/ASIC3 channel. Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors and is linked to neuronal morphology regulation and AMPA receptor (AMPAR) endocytosis. Via interaction with the Arp2/3 complex involved in regulation of synaptic plasicity of excitatory synapses and required for spine shrinkage during long-term depression (LTD). Involved in regulation of astrocyte morphology, antagonistic to Arp2/3 complex activator WASL/N-WASP function.
Subcellular Location
Cytoplasm, perinuclear region, Membrane, Peripheral membrane protein, Membrane, Lipid-anchor, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density, Cell junction, synapse, synaptosome, Cytoplasm, cytoskeleton
Tissue Specificity
Ubiquitous.
Tag Information
N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close