Comparison

Recombinant Human C-X-C motif chemokine 5 protein(CXCL5),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP061574h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
ENA-78(1-78)Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5
AA Sequence
AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAI GPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKI LDGG
Research Topic
Immunology
Uniprot ID
P42830
Gene Names
CXCL5
Tag Info
N-terminal 6xHis-tagged
Expression Region
37-110aa
MW of Fusion Proten
11, 9
Sequence Info
Partial
Relevance
Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granulocytes.
Reference
Regulation of the immune response by the interaction of chemokines and proteases.Struyf S., Proost P., Van Damme J.Adv. Immunol. 81:1-44(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close