« Back
Home /
Recombinant Human C-X-C motif chemokine 5 (CXCL5),partial

Recombinant Human C-X-C motif chemokine 5 (CXCL5),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-RP061574h-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Immunology
Target / Protein	CXCL5
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P42830
AA Sequence	AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAI GPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKI LDGG
Tag Info	N-terminal 6xHis-tagged
Expression Region	37-110aa
Protein length	Partial
MW	11.9 kDa
Alternative Name(s)	ENA-78(1-78)Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5
Relevance	Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granulocytes.
References	Regulation of the immune response by the interaction of chemokines and proteases.Struyf S., Proost P., Van Damme J.Adv. Immunol. 81:1-44(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Subcellular Location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time