Comparison

Recombinant Human Fibroblast growth factor 19 protein(FGF-19) ,partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP063944h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
PHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADG VVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYL CMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRS EKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPM VPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGL EAVRSPSFEK
Research Topic
Signal Transduction
Uniprot ID
O95750
Gene Names
FGF-19
Tag Info
N-terminal GST-tagged
Expression Region
32-216aa
MW of Fusion Proten
47, 8
Sequence Info
Partial
Relevance
Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Reference
Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain.Nishimura T., Utsunomiya Y., Hoshikawa M., Ohuchi H., Itoh N.Biochim. Biophys. Acta 1444:148-151(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close