« Back
Home /
Recombinant Human Transforming growth factor beta-1(TGFB1),partial

Recombinant Human Transforming growth factor beta-1(TGFB1),partial

Item no.	CSB-RP073094h-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPK GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVR SCKCS
Protein Family	TGF-beta family
Citations	Intron-exon structure of the human transforming growth factor-beta precursor gene.Derynck R., Rhee L., Chen E.Y., van Tilburg A.Nucleic Acids Res. 15:3188-3189(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	16.6 kDa
General Research Areas	Signal Transduction
Relevance	Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone rodeling as it is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.
Expression Region	281-390aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP)
Subcellular Location	Secreted, extracellular space, extracellular matrix
Tissue Specificity	Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage.
Involvement in disease	Camurati-Engelmann disease (CAEND)
Paythway	Hipposignalingpathway
Gene Names	TGFB
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer