« Back
Home /
Recombinant Human Tumor necrosis factor receptor superfamily member 11A(TNFRSF11A),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 11A(TNFRSF11A),partial

Item no.	CSB-RP084674h-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lymphatic System Cancer
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTT TSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKA LVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTE CAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTD KCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
Citations	A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Osteoclast differentiation factor receptor ,ODFRReceptor activator of NF-KB,CD265
Available
Manufacturer - Targets	TNFRSF11A
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	23.2 kDa
General Research Areas	Immunology
Relevance	Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Expression Region	28-202aa
Protein Length	Partial
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Subcellular Location	Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform RANK-e5a: Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.
Involvement in disease	Familial expansile osteolysis (FEO); Paget disease of bone 2, early-onset (PDB2); Osteopetrosis, autosomal recessive 7 (OPTB7)
Pathway	NF-kappaBsignalingpathway
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 2/12/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer