« Back
Home /
Recombinant Human Kallikrein-10(KLK10),partial

Recombinant Human Kallikrein-10(KLK10),partial

Item no.	CSB-RP140394h-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Breast Cancer Testicular & Prostate Cancer Adhesion Molecule Markers
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFN GLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDH LLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDE HDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQ VAGWGTTAARRVKYNKGLTCSSITILSPKECEVFY PGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQ GILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR
Protein Family	Peptidase S1 family, Kallikrein subfamily
Citations	The role for NES1 serine protease as a novel tumor suppressor.Goyal J., Smith K.M., Cowan J.M., Wazer D.E., Lee S.W., Band V.Cancer Res. 58:4782-4786(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Normal epithelial cell-specific 1,Protease serine-like 1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	30.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cell Cycle
Relevance	Has a tumor-suppressor role for NES1 in breast and prostate cancer.
Expression Region	31-274aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has a tumor-suppressor role for NES1 in breast and prostate cancer.
Subcellular Location	Secreted
Tissue Specificity	Expressed in breast, ovary and prostate.
Gene Names	KLK10
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 11/6/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer