« Back
Home /
Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial

Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial

Item no.	CSB-RP165694Ye(N)-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KKRQRIINCVTQLPYKIQLGESNDDWKISATTGNS ALFSSLEYLQFDSTEYEQHVVGWTGEITRTERNLF TREAKEKPQDLDDDPLYLTKEQINGLTTTLQDHMK SDKEAKTDTTQTAPVTNNVHPVWLLRKNQSRWRNY AEKVIWPTFHYILNPSNEGEQEKNWWYDYVKFNEA YAQKIGEVYRKGDIIWIHDYYLLLLPQLLRMKFND ESIIIGYFHHAPWPSNEYFRCLP
Protein Family	Glycosyltransferase 20 family; Trehalose phosphatase family
Citations	Disruption of TPS2, the gene encoding the 100-KDA subunit of the trehalose-6-phosphate synthase/phosphatase complex in Saccharomyces cerevisiae, causes accumulation of trehalose-6-phosphate and loss of trehalose-6-phosphate phosphatase activity.de Virgilio C., Buerckert N., Bell W., Jenoe P., Boller T., Wiemken A.Eur. J. Biochem. 212:315-323(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Trehalose synthase complex catalytic subunit TPS2Trehalose-6-phosphate phosphatase ;TPP
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	31.8 kDa
Relevance	Phosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6-phosphate and UDP-glucose in a two step process.
Expression Region	11-243aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Phosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6-phosphate and UDP-glucose in a two step process.
Subcellular Location	Cytoplasm
Gene Names	TPS2
Sequence Info	Partial
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer