Comparison

Recombinant Mouse Multidrug resistance protein 3(Abcb4),partial

Item no. CSB-YP001050MO-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDN IKGNLEFSDVHFSYPSRANIKILKGLNLKVKSGQT VALVGNSGCGKSTTVQLLQRLYDPTEGKISIDGQD IRNFNVRCLREIIGVVSQEPVLFSTTIAENIRYGR GNVTMDEIEKAVKEANAYDFIMKLPQKFDTLVGDR GAQLSGGQKQRIAIARALVRNPKILLLDEATSALD TESEAEVQAALDKAREGRTTIVIAHRLSTIRNADV IAG
Citations "Bile salt-stimulated phospholipid efflux mediated by ABCB4 localized in nonraft membranes."Morita S.Y., Tsuda T., Horikami M., Teraoka R., Kitagawa S., Terada T.J. Lipid Res. 54:1221-1230(2013)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ATP-binding cassette sub-family B member 4Imported; Multidrug resistance protein 21 Publication; Multidrug resistance protein 3By similarity (EC:3.6.3.44); P-glycoprotein 2By similarity; P-glycoprotein 3By similarity
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
MW of Fusion: 41, 6
Relevance
Energy-dependent phospholipid efflux translocator that acts as a positive regulator of biliary lipid secretion. Functions as a floppase that translocates specifically phosphatidylcholine (PC) from the inner to the outer leaflet of the canalicular membrane bilayer into the canaliculi between hepatocytes. Translocation of PC makes the biliary phospholipids available for extraction into the canaliculi lumen by bile salt mixed micelles and therefore protects the biliary tree from the detergent activity of bile salts (PubMed:8106172, PubMed:7912658, PubMed:7592705, PubMed:7814632, PubMed:8725158, PubMed:9366571). Plays a role in the recruitment of phosphatidylcholine (PC), phosphatidylethanolamine (PE) and sphingomyelin (SM) molecules to nonraft membranes and to further enrichment of SM and cholesterol in raft membranes in hepatocytes (By similarity). Required for proper phospholipid bile formation (PubMed:8106172). Indirectly involved in cholesterol efflux activity from hepatocytes into the canalicular lumen in the presence of bile salts in an ATP-dependent manner (PubMed:7814632, PubMed:8725158). May promote biliary phospholipid secretion as canaliculi-containing vesicles from the canalicular plasma membrane (PubMed:9366571). In cooperation with ATP8B1, functions to protect hepatocytes from the deleterious detergent activity of bile salts (PubMed:21820390). Does not confer multidrug resistance (PubMed:1990275)
Expression Region
352-708aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
Abcb4
Sequence Info
Cytoplasmic Domain
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close