Comparison

Recombinant Mouse Annexin A1(Anxa1)

Item no. CSB-YP001836MO-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Mouse (Murine, Mus musculus)
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AMVSEFLKQARFLENQEQEYVQAVKSYKGGPGSAV SPYPSFNVSSDVAALHKAIMVKGVDEATIIDILTK RTNAQRQQIKAAYLQENGKPLDEVLRKALTGHLEE VVLAMLKTPAQFDADELRGAMKGLGTDEDTLIEIL TTRSNEQIREINRVYREELKRDLAKDITSDTSGDF RKALLALAKGDRCQDLSVNQDLADTDARALYEAGE RRKGTDVNVFTTILTSRSFPHLRRVFQNYGKYSQH DMN
Protein Family Annexin family
Citations SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Annexin I;Annexin-1;Calpactin II;Calpactin-2;Chromobindin-9;Lipocortin I;Phospholipase A2 inhibitory protein;p35
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
40.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Calcium/phospholipid-binding protein which promotes mbrane fusion and is involved in exocytosis. This protein regulates phospholipase A2 activity. It ses to bind from two to four calcium ions with high affinity.
Biologically Active
Not Test
Expression Region
2-346aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays important roles in the innate immune response as effector of glucocorticoid-mediated responses and regulator of the inflammatory process. Has anti-inflammatory activity
Subcellular Location
Nucleus, Cytoplasm, Cell projection, cilium, Basolateral cell membrane, Lateral cell membrane, Cell membrane, Peripheral membrane protein, Apical cell membrane, Membrane, Peripheral membrane protein, Early endosome, Cytoplasmic vesicle membrane, Peripheral membrane protein, Endosome membrane, Peripheral membrane protein, Secreted, Secreted, extracellular space, Cell membrane, Peripheral membrane protein, Extracellular side, Secreted, exosome, Cytoplasmic vesicle, secretory vesicle lumen, Cell projection, phagocytic cup
Tissue Specificity
Detected in lung (PubMed:12475898, PubMed:17384087). Detected at the apical membrane of airway epithelial cells (PubMed:17384087). Detected in intestinal epithelial cells (PubMed:18802107). Detected in skeletal muscle (PubMed:14506282). Detected in prostate (PubMed:23727357). Detected in thymus (at protein level) (PubMed:12475898). Detected in stomach, lung, spleen, ovary and uterus, and at lower levels in kidney, thymus and heart (PubMed:12475898).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Delivery expected until 9/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close