« Back
Home /
Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)

Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)

Item no.	CSB-YP005196MO-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLV ANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSA AVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTL SKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGN SPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCA GGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFG SSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Protein Family	Peptidase S1 family, Elastase subfamily
Citations	"Wnk1 kinase deficiency lowers blood pressure in mice: a gene-trap screen to identify potential targets for therapeutic intervention." Zambrowicz B.P., Abuin A., Ramirez-Solis R., Richter L.J., Piggott J., BeltrandelRio H., Buxton E.C., Edwards J., Finch R.A., Friddle C.J., Gupta A., Hansen G., Hu Y., Huang W., Jaing C., Key B.W. Jr., Kipp P., Kohlhauff B. Sands A.T.Proc. Natl. Acad. Sci. U.S.A. 100:14109-14114(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Elastase-2; Elastase-2A
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	27.7 kDa
Relevance	Acts upon elastin.
Expression Region	31-271aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts upon elastin.
Subcellular Location	Secreted
Tissue Specificity	Pancreas.
Gene Names	Cela2a
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP005196MO-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer