« Back
Home /
Recombinant Human C-X-C chemokine receptor type 3(CXCR3)

Recombinant Human C-X-C chemokine receptor type 3(CXCR3)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Neuroinflammation Peptides & Proteins Recombinant Proteins Stem Cell Markers
Type	Proteins
Specific against	other
Amount	500ug
Host	Yeast
Item no.	CSB-YP006253HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alternative Name(s)	CKR-L2 G protein-coupled receptor 9 Interferon-inducible protein 10 receptor Short name: IP-10 receptor CD_antigen: CD183
AA Sequence	MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESD SCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLG NGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLT LPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGAL LLACISFDRYLNIVHATQLYRRGPPARVTLTCLAV WGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVS RGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL MDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNP LLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSS SRRDSSWSETSEASYSGL
Research Topic	Cardiovascular
Uniprot ID	P49682
Gene Names	CXCR3
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-368aa
MW of Fusion Proten	42, 7
Sequence Info	Full Length
Relevance	Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway . Binds to CCL21. Probably promotes cell chemotaxis response.
Reference	"An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4."Lasagni L., Francalanci M., Annunziato F., Lazzeri E., Giannini S., Cosmi L., Sagrinati C., Mazzinghi B., Orlando C., Maggi E., Marra F., Romagnani S., Serio M., Romagnani P.J. Exp. Med. 197:1537-1549(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time