« Back
Home /
Recombinant Human Dopamine beta-hydroxylase(DBH),partial

Recombinant Human Dopamine beta-hydroxylase(DBH),partial

Item no.	CSB-YP006518HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SAPRESPLPYHIPLDPEGSLELSWNVSYTQEAIHF QLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDT AYFADAWSDQKGQIHLDPQQDYQLLQVQRTPEGLT LLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRS LEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTM EVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKY EPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCD SKM
Protein Family	Copper type II ascorbate-dependent monooxygenase family
Citations	"The primary structure of human dopamine-beta-hydroxylase: insights into the relationship between the soluble and the membrane-bound forms of the enzyme."Lamouroux A., Vigny A., Faucon Biguet N., Darmon M.C., Franck R., Henry J.-P., Mallet J.EMBO J. 6:3931-3937(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Dopamine beta-monooxygenase; Cleaved into the following chain:; Soluble dopamine beta-hydroxylase
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	66.9 kDa
General Research Areas	Neuroscience
Relevance	Conversion of dopamine to noradrenaline.
Expression Region	40-617aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Conversion of dopamine to noradrenaline.
Subcellular Location	Soluble dopamine beta-hydroxylase: Cytoplasmic vesicle, secretory vesicle lumen, Cytoplasmic vesicle, secretory vesicle, chromaffin granule lumen, Secreted, SUBCELLULAR LOCATION: Cytoplasmic vesicle, secretory vesicle membrane, Single-pass type II membrane protein, Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane, Single-pass type II membrane protein
Involvement in disease	Dopamine beta-hydroxylase deficiency (DBH deficiency)
Gene Names	DBH
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP006518HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time