« Back
Home /
Recombinant Macaca fascicularis Erythropoietin(EPO)

Recombinant Macaca fascicularis Erythropoietin(EPO)

Item no.	CSB-YP007743MOV-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	APPRLICDSRVLERYLLEAKEAENVTMGCSESCSL NENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALL SEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSI TTLLRALGAQEAISLPDAASAAPLRTITADTFCKL FRVYSNFLRGKLKLYTGEACRRGDR
Protein Family	EPO/TPO family
Citations	"Monkey erythropoietin gene: cloning, expression and comparison with the human erythropoietin gene."Lin F.-K., Lin C.-H., Lai P.-H., Browne J.K., Egrie J.C., Smalling R., Fox G.M., Chen K.K., Castro M., Suggs S.Gene 44:201-209(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	20.2 kDa
Relevance	Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Expression Region	28-192aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location	Secreted
Tissue Specificity	Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Gene Names	EPO
Sequence Info	Full Length of Mature Protein
Organism	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP007743MOV-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer