Comparison

Recombinant Human Fibroblast growth factor receptor 1(FGFR1),partial

Item no. CSB-YP008642HUa4-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCR LRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDS VPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSE DDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKM EKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKE FKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCI VENEYGSINHTYQLDVVERSPHRPILQAGLPANKT VAL
Protein Family Protein kinase superfamily, Tyr protein kinase family, Fibroblast growth factor receptor subfamily
Citations Alternative splicing generates at least five different isoforms of the human basic-FGF receptor.
Eisemann A., Ahn J.A., Graziani G., Tronick S.R., Ron D.
Oncogene 6:1195-1202(1991)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Basic fibroblast growth factor receptor 1; Short name:; BFGFR; Short name:; bFGF-R-1; Fms-like tyrosine kinase 2; Short name:; FLT-2; N-sam; Proto-oncogene c-Fgr; CD_antigen: CD331; BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-sumostar-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
55.4 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cancer
Relevance
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1, 4, 5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation.
Expression Region
22-376aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1, 4, 5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation.
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Nucleus, Cytoplasm, cytosol, Cytoplasmic vesicle
Tissue Specificity
Detected in astrocytoma, neuroblastoma and adrenal cortex cell lines. Some isoforms are detected in foreskin fibroblast cell lines, however isoform 17, isoform 18 and isoform 19 are not detected in these cells.
Involvement in disease
Pfeiffer syndrome (PS); Hypogonadotropic hypogonadism 2 with or without anosmia (HH2); Osteoglophonic dysplasia (OGD); Hartsfield syndrome (HRTFDS); Trigonocephaly 1 (TRIGNO1); Encephalocraniocutaneous lipomatosis (ECCL); Jackson-Weiss syndrome (JWS)
Paythway
MAPKsignalingpathway
Gene Names
FGFR1
Sequence Info
Partial
Organism
Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close