« Back
Home /
Recombinant Human Eukaryotic peptide chain release factor GTP-binding subunit ERF3A(GSPT1)

Recombinant Human Eukaryotic peptide chain release factor GTP-binding subunit ERF3A(GSPT1)

Item no.	CSB-YP009966HU-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MELSEPIVENGETEMSPEESWEHKEEISEAEPGGG SLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAP KKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRT LEKYEREAKEKNRETWYLSWALDTNQEERDKGKTV EVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQ ADLAVLVISARKGEFETGFEKGGQTREHAMLAKTA GVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFL KKV
Protein Family	TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, ERF3 subfamily
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	59.8 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ERF1. Involved in regulation of mammalian cell growth. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
Expression Region	1-499aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ERF1. Involved in regulation of mammalian cell growth. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
Gene Names	GSPT1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP009966HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer