« Back
Home /
Recombinant Human Islet cell autoantigen 1(ICA1)

Recombinant Human Islet cell autoantigen 1(ICA1)

Manufacturer	Cusabio
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	Yeast
Item no.	CSB-YP010947HU(F1)-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Neuroscience
Uniprot ID	Q05084
Gene Names	ICA1
Organism	Homo sapiens (Human)
AA Sequence	MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQA FIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDK TRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDV SQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTS HTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSS FKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLE EGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWF SLFADLDPLSNPDAVGKTDKEHELLNA
Expression Region	1-482aa
Sequence Info	Full Length of Isoform 3
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	56.6 kDa
Alternative Name(s)	69KDA islet cell autoantigen Short name: ICA69 Islet cell autoantigen p69 Short name: ICAp69 Short name: p69
Relevance	May play a role in neurotransmitter secretion.
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004).
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play a role in neurotransmitter secretion.
Subcellular Location	Cytoplasm, cytosol, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Peripheral membrane protein
Tissue Specificity	Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time