« Back
Home /
Recombinant Mouse Interferon alpha/beta receptor 2(Ifnar2),partial

Recombinant Mouse Interferon alpha/beta receptor 2(Ifnar2),partial

Item no.	CSB-YP011047MO-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Lineage Markers Neural Transcription Factors Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SLETITPSAFDGYPDEPCTINITIRNSRLILSWEL ENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKS SCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDY IVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKI IQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNF TFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQ PGQESGLSESA
Protein Family	Type II cytokine receptor family
Citations	Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Type I interferon receptor 2
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	26.8 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and 3 may be potent inhibitors of type I IFN receptor activity .
Expression Region	22-242aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and isoform 3 may be potent inhibitors of type I IFN receptor activity.
Subcellular Location	Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted
Tissue Specificity	Widely expressed. Detected in liver, testis, kidney, salivary gland, thymus, brain, lung and placenta. Isoform 1, isoform 2 and isoform 3 are expressed in brain.
Gene Names	Ifnar2
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP011047MO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/20/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer