« Back
Home /
Recombinant Mouse Monoglyceride lipase(Mgll)

Recombinant Mouse Monoglyceride lipase(Mgll)

Manufacturer	Cusabio
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	Yeast
Item no.	CSB-YP013787MO-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cardiovascular
Uniprot ID	O35678
Gene Names	Mgll
Organism	Mus musculus (Mouse)
AA Sequence	MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYW KPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDM LVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVD TIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFS GMVLISPLVLANPESASTLKVLAAKLLNFVLPNMT LGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFG IQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSK GAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTN SVLHEVNSWVSHRIAAAGAGCPP
Expression Region	1-303aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	35.4 kDa
Alternative Name(s)	Short name: MGL Alternative name(s): Monoacylglycerol lipase Short name: MAGL
Relevance	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:9341166, PubMed:17700715, PubMed:18096503, PubMed:19029917, PubMed:20729846). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (By similarity).
Reference	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain
Subcellular Location	Cytoplasm, cytosol, Membrane, Peripheral membrane protein
Protein Families	AB hydrolase superfamily, Monoacylglycerol lipase family
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time