« Back
Home /
Recombinant Human Matrix metalloproteinase-9(MMP9) ,partial

Recombinant Human Matrix metalloproteinase-9(MMP9) ,partial

Item no.	CSB-YP014679HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAF ARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHG DGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWS LGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTT DGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDG NADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCAT TANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPF TFL
Protein Family	Peptidase M10A family
Citations	SV40-transformed human lung fibroblasts secrete a 92-KDA type IV collagenase which is identical to that secreted by normal human macrophages.Wilhelm S.M., Collier I.E., Marmer B.L., Eisen A.Z., Grant G.A., Goldberg G.I.J. Biol. Chem. 264:17213-17221(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	92KDA gelatinase92KDA type IV collagenaseGelatinase B ;GELB
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	68.6 kDa
General Research Areas	Developmental Biology
Relevance	May play an essential role in local proteolysis of the Extracellular domain matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-\|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Expression Region	107-707aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-\|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Subcellular Location	Secreted, extracellular space, extracellular matrix
Tissue Specificity	Produced by normal alveolar macrophages and granulocytes.
Involvement in disease	Intervertebral disc disease (IDD); Metaphyseal anadysplasia 2 (MANDP2)
Paythway	Estrogensignalingpathway
Gene Names	MMP9
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP014679HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/23/2025

Compare

Add to wishlist

Get an offer

Request delivery time