« Back
Home /
Recombinant Bovine Enteropeptidase(TMPRSS15),partial

Recombinant Bovine Enteropeptidase(TMPRSS15),partial

Item no.	CSB-YP018824BO-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDW LVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQI ETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYT DYIQPICLPEENQVFPPGRICSIAGWGALIYQGST ADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGY EAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQ CALPNRPGVYARVPRFTEWIQSFLH
Protein Family	Peptidase S1 family
Citations	"Enterokinase, the initiator of intestinal digestion, is a mosaic protease composed of a distinctive assortment of domains." Kitamoto Y., Yuan X., Wu Q., McCourt D.W., Sadler J.E. Proc. Natl. Acad. Sci. U.S.A. 91:7588-7592(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Enterokinase; Serine protease 7; Transmembrane protease serine 15; ENTK, PRSS7
Available
Manufacturer - Conjugate / Tag	C-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	28.3 kDa
General Research Areas	Cell Biology
Relevance	Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
Expression Region	801-1035
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
Subcellular Location	Membrane, Single-pass type II membrane protein
Tissue Specificity	Intestinal brush border.
Gene Names	TMPRSS15
Sequence Info	Partial
Organism	Bos taurus (Bovine)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP018824BO-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer