« Back
Home /
Recombinant Human Semaphorin-7A(SEMA7A)

Recombinant Human Semaphorin-7A(SEMA7A)

Manufacturer	Cusabio
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Renal Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	Yeast
Item no.	CSB-YP021000HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cardiovascular
Uniprot ID	O75326
Gene Names	SEMA7A
Organism	Homo sapiens (Human)
AA Sequence	QGHLRSGPRIFAVWKGHVGQDRVDFGQTEPHTVLF HEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIG STKGSCLDKRDCENYITLLERRSEGLLACGTNARH PSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEG DEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVM QNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPE APLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAML VCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGV FSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLP NPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPM GPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYL TTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAA IQTMSLDAERRKLYVSSQWEVSQVPLDLCEVYGGG CHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINP AEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME SRHATYSWRHKENVEQSCEPGHQSPNCILFIENLT AQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEH LLGHACALA
Expression Region	45-648aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	70.4 kDa
Alternative Name(s)	CDw108 JMH blood group antigen John-Milton-Hargen human blood group Ag Semaphorin-K1 Short name: Sema K1 Semaphorin-L Short name: Sema L CD_antigen: CD108
Relevance	Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.
Reference	"Semaphorin 7A promotes axon outgrowth through integrins and MAPKs."Pasterkamp R.J., Peschon J.J., Spriggs M.K., Kolodkin A.L.Nature 424:398-405(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side
Protein Families	Semaphorin family
Tissue Specificity	Detected in skin keratinocytes and on endothelial cells from skin blood vessels (at protein level). Expressed in fibroblasts, keratinocytes, melanocytes, placenta, testis, ovary, spleen, brain, spinal chord, lung, heart, adrenal gland, lymph nodes, thymus, intestine and kidney.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time