« Back
Home /
Recombinant Rat Alpha-1-antiproteinase(Serpina1)

Recombinant Rat Alpha-1-antiproteinase(Serpina1)

Item no.	CSB-YP021053RA-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Proteins Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EDAQETDTSQQDQSPTYRKISSNLADFAFSLYREL VHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQI LEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQ LNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVN FADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTV FALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTV KVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAI FLL
Protein Family	Serpin family
Citations	Cloning and expression in Escherichia coli of full-length complementary DNA coding for human alpha 1-antitrypsin.Bollen A., Herzog A., Cravador A., Herion P., Chuchana P., van der Straten A., Loriau R., Jacobs P., van Elsen A.DNA 2:255-264(1983)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Alpha-1 protease inhibitorAlpha-1-antiproteinase;Serpin A1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	45.7 kDa
General Research Areas	Immunology
Relevance	Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
Expression Region	25-411aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibitor of serine proteases. The primary target is elastase, but also has a moderate affinity for plasmin and thrombin.
Subcellular Location	Secreted
Tissue Specificity	Plasma.
Gene Names	Serpina1
Sequence Info	Full Length of Mature Protein
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP021053RA-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer