« Back
Home /
Recombinant Human Toll-like receptor 1(TLR1),partial

Recombinant Human Toll-like receptor 1(TLR1),partial

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Neuroinflammation Neurodegeneration Markers;Products Peptides & Proteins Recombinant Proteins general
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	Yeast
Item no.	CSB-YP023599HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Immunology
Uniprot ID	Q15399
Gene Names	TLR1
Organism	Homo sapiens (Human)
AA Sequence	SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISE LWTSDILSLSKLRILIISHNRIQYLDISVFKFNQE LEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDAL PICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNI SKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTN KEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFL SILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVW HTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSI HQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMV HMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTEL ETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNS VSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLP PRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNS LTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQ KMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEG WPDSYKCDYPESYRGTLLKDFHMSELSCNIT
Expression Region	25-580aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	65.2 kDa
Alternative Name(s)	Toll/interleukin-1 receptor-like protein Short name: TIL CD_antigen: CD281
Relevance	Participates in the innate immune response to microbial agents. Specifically recognizes diacylated and triacylated lipopeptides. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response
Reference	Functional characterization of naturally occurring genetic variants in the human TLR1-2-6 gene family.Ben-Ali M., Corre B., Manry J., Barreiro L.B., Quach H., Boniotto M., Pellegrini S., Quintana-Murci L.Hum. Mutat. 32:643-652(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time