« Back
Home /
Recombinant Macaca fascicularis Trophoblast glycoprotein(TPBG),partial

Recombinant Macaca fascicularis Trophoblast glycoprotein(TPBG),partial

Item no.	CSB-YP024093MOV-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	TSSASSSSSSAPFLASAASAQPPLPDQCPALCECS EAARTVKCVNRNLTEVPTDLPLYVRNLFLTGNQLA VLPAGAFARRPPLAELAALNLSGSRLDEVRGGAFE HLPSLRQLDLSHNPLAYLSPFAFSGSNASISAPSP LVELILNHIVPPDDKRQNRSFEGMVAAALVAGRAL QGLHLLELASNHFLYLPRDVLAQLPSLRYLDLSNN SLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLA ELQ
Citations	"DNA sequences of macaque genes expressed in brain or testis and its evolutionary implications." International consortium for macaque cDNA sequencing and analysis Submitted (JUN-2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Wnt-activated inhibitory factor 1; Short name:; WAIF1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	36.9 kDa
Relevance	May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Expression Region	35-355aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Gene Names	TPBG
Sequence Info	Partial
Organism	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP024093MOV-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer