« Back
Home /
Recombinant Enterobacteria phage M13 Attachment protein G3P(III)

Recombinant Enterobacteria phage M13 Attachment protein G3P(III)

Item no.	CSB-YP303116ECY-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEG CLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGG GSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINP LDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNR FRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKA MYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDL PQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSE GGG
Protein Family	Inovirus G3P protein family
Citations	"Filamentous phage infection: crystal structure of g3p in complex with its coreceptor, the C-terminal domain of TolA."Lubkowski J., Hennecke F., Plueckthun A., Wlodawer A.Structure 7:711-722(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Gene 3 protein; Short name:; G3P; Minor coat protein
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.6 kDa
Relevance	Plays essential roles both in the penetration of the viral genome into the bacterial host via pilus retraction and in the extrusion process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of host F-pilus. Subsequent interaction with the host entry receptor tolA induces penetration of the viral DNA into the host cytoplasm. In the extrusion process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain.
Expression Region	19-424aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays essential roles both in the penetration of the viral genome into the bacterial host via pilus retraction and in the extrusion process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of host F-pilus. Subsequent interaction with the host entry receptor tolA induces penetration of the viral DNA into the host cytoplasm. In the extrusion process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain.
Subcellular Location	Virion, Host membrane, Single-pass type I membrane protein
Gene Names	III
Sequence Info	Full Length of Mature Protein
Organism	Enterobacteria phage M13 (Bacteriophage M13)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP303116ECY-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time